ME3 anticorps

N° du produit ABIN631075

Détail du produit anti-ME3 anticorps

Antigène: ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ME3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ME3 Blocking Peptide, catalog no. 33R-7120, is also available for use as a blocking control in assays to test for specificity of this ME3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ME3

Antigène: ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))

Autre désignation: ME3 (ME3 Produits)

Synonymes: anticorps NADP-ME, anticorps 1700020C08Rik, anticorps B230207H15Rik, anticorps im:7151680, anticorps wu:fi43b04, anticorps zgc:163117, anticorps malic enzyme 3, anticorps malic enzyme 3, NADP(+)-dependent, mitochondrial, anticorps malic enzyme 3, NADP(+)-dependent, mitochondrial L homeolog, anticorps NADP malic enzyme 3, anticorps ME3, anticorps Me3, anticorps me3, anticorps me3.L

Sujet: Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: L'effet Warburg