NDUFC1 anticorps
-
- Antigène Voir toutes NDUFC1 Anticorps
- NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NDUFC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL
- Top Product
- Discover our top product NDUFC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NDUFC1 Blocking Peptide, catalog no. 33R-8188, is also available for use as a blocking control in assays to test for specificity of this NDUFC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))
- Autre désignation
- NDUFC1 (NDUFC1 Produits)
- Synonymes
- anticorps 2310016K22Rik, anticorps KFYI, anticorps CI-KFYI, anticorps NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, anticorps NADH:ubiquinone oxidoreductase subunit C1, anticorps Ndufc1, anticorps NDUFC1
- Sujet
- NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain.
- Poids moléculaire
- 9 kDa (MW of target protein)
-