GATM anticorps

N° du produit ABIN631084

Détail du produit anti-GATM anticorps

Antigène: GATM (Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GATM est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GATM antibody was raised using a synthetic peptide corresponding to a region with amino acids PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GATM Blocking Peptide, catalog no. 33R-6995, is also available for use as a blocking control in assays to test for specificity of this GATM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GATM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GATM

Antigène: GATM (Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM))

Autre désignation: GATM (GATM Produits)

Synonymes: anticorps AT, anticorps AGAT, anticorps CCDS3, anticorps 1810003P21Rik, anticorps AI314789, anticorps cb409, anticorps wu:fa08a06, anticorps zgc:65855, anticorps glycine amidinotransferase (L-arginine:glycine amidinotransferase) L homeolog, anticorps glycine amidinotransferase, anticorps glycine amidinotransferase (L-arginine:glycine amidinotransferase), anticorps gatm.L, anticorps GATM, anticorps Gatm, anticorps gatm

Sujet: GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.

Poids moléculaire: 44 kDa (MW of target protein)