MTO1 anticorps

N° du produit ABIN631087

Détail du produit anti-MTO1 anticorps

Antigène: MTO1

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTO1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTO1 Blocking Peptide, catalog no. 33R-8897, is also available for use as a blocking control in assays to test for specificity of this MTO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTO1

Antigène: MTO1

Abstract: MTO1 Produits

Synonymes: anticorps 2310039H01Rik, anticorps 5730419A02Rik, anticorps COXPD10, anticorps mitochondrial tRNA translation optimization 1, anticorps Mto1, anticorps MTO1

Sujet: MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.

Poids moléculaire: 81 kDa (MW of target protein)