Cytochrome C1 anticorps (Middle Region)

N° du produit ABIN631089

Détail du produit anti-Cytochrome C1 anticorps

Antigène: Cytochrome C1 (CYC1)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytochrome C1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYC1 antibody was raised against the middle region of CYC1

Purification: Affinity purified

Immunogène: CYC1 antibody was raised using the middle region of CYC1 corresponding to a region with amino acids RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYC1 Blocking Peptide, catalog no. 33R-8262, is also available for use as a blocking control in assays to test for specificity of this CYC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytochrome C1

Antigène: Cytochrome C1 (CYC1)

Autre désignation: CYC1 (CYC1 Produits)

Synonymes: anticorps DDBDRAFT_0184465, anticorps DDBDRAFT_0238603, anticorps DDB_0184465, anticorps DDB_0238603, anticorps UQCR4, anticorps 2610002H19Rik, anticorps AA408921, anticorps fb80h03, anticorps im:6911272, anticorps sr:nyz104, anticorps wu:fb80h03, anticorps zgc:123089, anticorps cytochrome c1, anticorps cytochrome c-1, anticorps cytochrome c-1 L homeolog, anticorps Sputw3181_0667, anticorps Shal_3628, anticorps Mpop_2472, anticorps Hneap_1140, anticorps cyc1, anticorps Bresu_2679, anticorps Fbal_3419, anticorps Sulku_2312, anticorps LOC100127128, anticorps ZMO0958, anticorps Rsph17029_0061, anticorps Mesop_2273, anticorps CYC1, anticorps Cyc1, anticorps cyc1.L

Sujet: CYC1 is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.

Poids moléculaire: 35 kDa (MW of target protein)