KLC3 anticorps (Middle Region)

N° du produit ABIN631090

Détail du produit anti-KLC3 anticorps

Antigène: KLC3 (Kinesin Light Chain 3 (KLC3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLC3 antibody was raised against the middle region of KLC3

Purification: Affinity purified

Immunogène: KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLC3 Blocking Peptide, catalog no. 33R-6199, is also available for use as a blocking control in assays to test for specificity of this KLC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLC3

Antigène: KLC3 (Kinesin Light Chain 3 (KLC3))

Autre désignation: KLC3 (KLC3 Produits)

Synonymes: anticorps wu:fk22d07, anticorps zgc:153164, anticorps KLC2, anticorps KLC2L, anticorps KLCt, anticorps KNS2B, anticorps BC017147, anticorps Klct, anticorps kinesin light chain 3, anticorps KLC3, anticorps klc3, anticorps PTRG_03762, anticorps PTRG_11380, anticorps PTRG_11942, anticorps Klc3

Sujet: KLC3 is a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.

Poids moléculaire: 55 kDa (MW of target protein)