MTCH2 anticorps
-
- Antigène Voir toutes MTCH2 Anticorps
- MTCH2 (Mitochondrial Carrier 2 (MTCH2))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MTCH2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV
- Top Product
- Discover our top product MTCH2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MTCH2 Blocking Peptide, catalog no. 33R-9116, is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MTCH2 (Mitochondrial Carrier 2 (MTCH2))
- Autre désignation
- MTCH2 (MTCH2 Produits)
- Synonymes
- anticorps MIMP, anticorps SLC25A50, anticorps Hspc032, anticorps fi20c06, anticorps fj35g12, anticorps wu:fi20c06, anticorps wu:fj35g12, anticorps 2310034D24Rik, anticorps 4930539J07Rik, anticorps HSPC032, anticorps mitochondrial carrier 2, anticorps mitochondrial carrier 2 L homeolog, anticorps mitochondrial carrier homolog 2, anticorps MTCH2, anticorps mtch2.L, anticorps Mtch2, anticorps mtch2
- Sujet
- MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.
- Poids moléculaire
- 33 kDa (MW of target protein)
-