MTCH2 anticorps

N° du produit ABIN631107

Cet anticorps anti-MTCH2 Polyclonal Lapin (ABIN631107) détecte spécifiquement MTCH2 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour MTCH2 anticorps (ABIN631107)

Antigène: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTCH2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MTCH2 anticorps

Purification: Affinity purified

Immunogène: MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTCH2 Blocking Peptide, (ABIN5614862), is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTCH2

Antigène: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Autre désignation: MTCH2

Sujet: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Poids moléculaire: 33 kDa (MW of target protein)