Lactate Dehydrogenase C anticorps (Middle Region)

N° du produit ABIN631115

L’anticorps anti-Lactate Dehydrogenase C Polyclonal Lapin est utilisé pour la détection de Lactate Dehydrogenase C dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour Lactate Dehydrogenase C anticorps (Middle Region) (ABIN631115)

Antigène: Lactate Dehydrogenase C (LDHC)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lactate Dehydrogenase C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Lactate Dehydrogenase C anticorps

Épitope: Middle Region

Specificité: LDHC antibody was raised against the middle region of LDHC

Purification: Affinity purified

Immunogène: LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LDHC Blocking Peptide, (ABIN939588), is also available for use as a blocking control in assays to test for specificity of this LDHC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lactate Dehydrogenase C

Antigène: Lactate Dehydrogenase C (LDHC)

Autre désignation: LDHC

Sujet: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, L'effet Warburg