Lactate Dehydrogenase C anticorps (Middle Region)

N° du produit ABIN631115

Détail du produit anti-Lactate Dehydrogenase C anticorps

Antigène: Lactate Dehydrogenase C (LDHC)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lactate Dehydrogenase C est non-conjugé

Application: Western Blotting (WB)

Specificité: LDHC antibody was raised against the middle region of LDHC

Purification: Affinity purified

Immunogène: LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LDHC Blocking Peptide, catalog no. 33R-4202, is also available for use as a blocking control in assays to test for specificity of this LDHC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lactate Dehydrogenase C

Antigène: Lactate Dehydrogenase C (LDHC)

Autre désignation: LDHC (LDHC Produits)

Synonymes: anticorps CT32, anticorps LDH3, anticorps LDHX, anticorps LDH-C4, anticorps Ldh-3, anticorps Ldh-x, anticorps Ldh3, anticorps Ldhc4, anticorps LDH-C, anticorps LDH-X, anticorps lactate dehydrogenase C, anticorps L-lactate dehydrogenase C chain, anticorps LDHC, anticorps Ldhc, anticorps ldhc, anticorps LOC100713414, anticorps LOC100343171

Sujet: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, L'effet Warburg