TAF7L anticorps
-
- Antigène Voir toutes TAF7L Anticorps
- TAF7L (TAF7-Like RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 50kDa (TAF7L))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TAF7L est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TAF7 L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ
- Top Product
- Discover our top product TAF7L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TAF7L Blocking Peptide, catalog no. 33R-7610, is also available for use as a blocking control in assays to test for specificity of this TAF7L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TAF7L (TAF7-Like RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 50kDa (TAF7L))
- Autre désignation
- TAF7L (TAF7L Produits)
- Synonymes
- anticorps 4933438I11Rik, anticorps 50kDa, anticorps Taf2q, anticorps RGD1564898, anticorps CT40, anticorps TAF2Q, anticorps TATA-box binding protein associated factor 7 like, anticorps TATA-box binding protein associated factor 7-like, anticorps Taf7l, anticorps TAF7L
- Sujet
- TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.
- Poids moléculaire
- 51 kDa (MW of target protein)
-