TKT anticorps

N° du produit ABIN631160

L’anticorps anti-TKT Polyclonal Lapin est utilisé pour la détection de TKT dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB.

Aperçu rapide pour TKT anticorps (ABIN631160)

Antigène: TKT (Transketolase (TKT))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TKT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TKT anticorps

Purification: Affinity purified

Immunogène: TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TKT Blocking Peptide, (ABIN938139), is also available for use as a blocking control in assays to test for specificity of this TKT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TKT

Antigène: TKT (Transketolase (TKT))

Autre désignation: TKT

Sujet: TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.

Poids moléculaire: 68 kDa (MW of target protein)