TKT anticorps

N° du produit ABIN631160

Détail du produit anti-TKT anticorps

Antigène: TKT (Transketolase (TKT))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TKT est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TKT Blocking Peptide, catalog no. 33R-2753, is also available for use as a blocking control in assays to test for specificity of this TKT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TKT

Antigène: TKT (Transketolase (TKT))

Autre désignation: TKT (TKT Produits)

Synonymes: anticorps TK, anticorps TKT1, anticorps p68, anticorps Dmel\\CG8036, anticorps anon-WO0118547.344, anticorps cb860, anticorps fb38f03, anticorps fj52f12, anticorps id:ibd3270, anticorps wu:cegs2794, anticorps wu:fb38f03, anticorps wu:fj52f12, anticorps tkt1, anticorps PSPTO0385, anticorps Tb08.11J15.550, anticorps xcc-b100_0966, anticorps transketolase, anticorps CG8036 gene product from transcript CG8036-RB, anticorps TransKeTolase homolog, anticorps transketolase b, anticorps transketolase L homeolog, anticorps transketolase Tkt, anticorps tkt, anticorps TKT, anticorps Tkt, anticorps CG8036, anticorps tkt-1, anticorps tktb, anticorps tkt.L, anticorps tkt, anticorps JK_RS05135, anticorps Tb927.8.6170, anticorps APH_RS01480

Sujet: TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.

Poids moléculaire: 68 kDa (MW of target protein)