FABP3 anticorps
-
- Antigène Voir toutes FABP3 Anticorps
- FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FABP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV
- Top Product
- Discover our top product FABP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FABP3 Blocking Peptide, catalog no. 33R-6549, is also available for use as a blocking control in assays to test for specificity of this FABP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))
- Autre désignation
- FABP3 (FABP3 Produits)
- Synonymes
- anticorps Fabph-1, anticorps Fabph-4, anticorps Fabph1, anticorps Fabph4, anticorps H-FABP, anticorps Mdgi, anticorps FABP11, anticorps M-FABP, anticorps MDGI, anticorps O-FABP, anticorps FABP, anticorps FABP-3, anticorps fabp3, anticorps fatty acid binding protein 3, anticorps fatty acid binding protein 3, muscle and heart, anticorps FABP3, anticorps Fabp3, anticorps fabp3
- Sujet
- The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. FABP3 gene is a candidate tumor suppressor gene for human breast cancer.
- Poids moléculaire
- 15 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-