FABP3 anticorps

N° du produit ABIN631167

Détail du produit anti-FABP3 anticorps

Antigène: FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FABP3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FABP3 Blocking Peptide, catalog no. 33R-6549, is also available for use as a blocking control in assays to test for specificity of this FABP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FABP3

Antigène: FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))

Autre désignation: FABP3 (FABP3 Produits)

Synonymes: anticorps Fabph-1, anticorps Fabph-4, anticorps Fabph1, anticorps Fabph4, anticorps H-FABP, anticorps Mdgi, anticorps FABP11, anticorps M-FABP, anticorps MDGI, anticorps O-FABP, anticorps FABP, anticorps FABP-3, anticorps fabp3, anticorps fatty acid binding protein 3, anticorps fatty acid binding protein 3, muscle and heart, anticorps FABP3, anticorps Fabp3, anticorps fabp3

Sujet: The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. FABP3 gene is a candidate tumor suppressor gene for human breast cancer.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process