SULT1B1 anticorps (N-Term)
-
- Antigène Voir toutes SULT1B1 Anticorps
- SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SULT1B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SULT1 B1 antibody was raised against the N terminal of SULT1 1
- Purification
- Affinity purified
- Immunogène
- SULT1 B1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG
- Top Product
- Discover our top product SULT1B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SULT1B1 Blocking Peptide, catalog no. 33R-6218, is also available for use as a blocking control in assays to test for specificity of this SULT1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))
- Autre désignation
- SULT1B1 (SULT1B1 Produits)
- Synonymes
- anticorps ST1B1, anticorps ST1B2, anticorps SULT1B2, anticorps St2b2, anticorps SULT1B, anticorps cSULT1B1, anticorps MGC80677, anticorps SULT1B1, anticorps sulfotransferase family 1B member 1, anticorps sulfotransferase family 1B, member 1, anticorps sulfotransferase family cytosolic 1B member 1, anticorps sulfotransferase family 1B member 1 S homeolog, anticorps sulfotransferase family, cytosolic, 1B, member 1, anticorps SULT1B1, anticorps Sult1b1, anticorps sult1b1.S, anticorps sult1b1, anticorps LOC100624541
- Sujet
- SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.
- Poids moléculaire
- 35 kDa (MW of target protein)
-