LONRF3 anticorps (Middle Region)
-
- Antigène Voir toutes LONRF3 Anticorps
- LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LONRF3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LONRF3 antibody was raised against the middle region of LONRF3
- Purification
- Affinity purified
- Immunogène
- LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG
- Top Product
- Discover our top product LONRF3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LONRF3 Blocking Peptide, catalog no. 33R-4906, is also available for use as a blocking control in assays to test for specificity of this LONRF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))
- Autre désignation
- LONRF3 (LONRF3 Produits)
- Synonymes
- anticorps RNF127, anticorps 4932412G04Rik, anticorps 5730439E01Rik, anticorps A830039N02Rik, anticorps AU023707, anticorps Rnf127, anticorps RGD1565451, anticorps LON peptidase N-terminal domain and ring finger 3, anticorps LONRF3, anticorps Lonrf3
- Sujet
- LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.
- Poids moléculaire
- 84 kDa (MW of target protein)
-