UBASH3A anticorps (Middle Region)

N° du produit ABIN631208

L’anticorps anti-UBASH3A Polyclonal Lapin est utilisé pour la détection de UBASH3A dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour UBASH3A anticorps (Middle Region) (ABIN631208)

Antigène: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBASH3A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBASH3A anticorps

Épitope: Middle Region

Specificité: UBASH3 A antibody was raised against the middle region of UBASH3

Purification: Affinity purified

Immunogène: UBASH3 A antibody was raised using the middle region of UBASH3 corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBASH3A Blocking Peptide, (ABIN5616858), is also available for use as a blocking control in assays to test for specificity of this UBASH3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBASH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBASH3A

Antigène: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Autre désignation: UBASH3A

Sujet: UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. It also promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.

Poids moléculaire: 74 kDa (MW of target protein)