UBASH3A anticorps (Middle Region)

N° du produit ABIN631208

Détail du produit anti-UBASH3A anticorps

Antigène: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBASH3A est non-conjugé

Application: Western Blotting (WB)

Specificité: UBASH3 A antibody was raised against the middle region of UBASH3

Purification: Affinity purified

Immunogène: UBASH3 A antibody was raised using the middle region of UBASH3 corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBASH3A Blocking Peptide, catalog no. 33R-7001, is also available for use as a blocking control in assays to test for specificity of this UBASH3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBASH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBASH3A

Antigène: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Autre désignation: UBASH3A (UBASH3A Produits)

Synonymes: anticorps UBASH3A, anticorps CLIP4, anticorps STS-2, anticorps TULA, anticorps TULA-1, anticorps 5830413C03Rik, anticorps C330001M22, anticorps Sts-2, anticorps ubiquitin associated and SH3 domain containing A, anticorps ubiquitin associated and SH3 domain containing, A, anticorps UBASH3A, anticorps Ubash3a

Sujet: UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. It also promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.

Poids moléculaire: 74 kDa (MW of target protein)