Mahogunin RING Finger Protein 1 anticorps (Middle Region)

N° du produit ABIN631214

Détail du produit anti-Mahogunin RING Finger Protein 1 anticorps

Antigène: Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Mahogunin RING Finger Protein 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MGRN1 antibody was raised against the middle region of MGRN1

Purification: Affinity purified

Immunogène: MGRN1 antibody was raised using the middle region of MGRN1 corresponding to a region with amino acids EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGRN1 Blocking Peptide, catalog no. 33R-2492, is also available for use as a blocking control in assays to test for specificity of this MGRN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGRN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Mahogunin RING Finger Protein 1

Antigène: Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))

Autre désignation: MGRN1 (MGRN1 Produits)

Synonymes: anticorps RNF156, anticorps 2610042J20Rik, anticorps mKIAA0544, anticorps md, anticorps nc, anticorps RGD1311862, anticorps mgrn1, anticorps wu:fi38c03, anticorps zgc:55978, anticorps mahogunin ring finger 1, anticorps mahogunin, ring finger 1, anticorps mahogunin ring finger 1, E3 ubiquitin protein ligase S homeolog, anticorps mahogunin ring finger 1, E3 ubiquitin protein ligase, anticorps mahogunin, ring finger 1a, anticorps MGRN1, anticorps Mgrn1, anticorps mgrn1.S, anticorps mgrn1, anticorps mgrn1a

Sujet: Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling