PTP4A3 anticorps (Middle Region)

N° du produit ABIN631230

Détail du produit anti-PTP4A3 anticorps

Antigène: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTP4A3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PTP4 A3 antibody was raised against the middle region of PTP4 3

Purification: Affinity purified

Immunogène: PTP4 A3 antibody was raised using the middle region of PTP4 3 corresponding to a region with amino acids LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTP4A3 Blocking Peptide, catalog no. 33R-4993, is also available for use as a blocking control in assays to test for specificity of this PTP4A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTP4A3

Antigène: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Autre désignation: PTP4A3 (PTP4A3 Produits)

Synonymes: anticorps PRL-3, anticorps PRL-R, anticorps PRL3, anticorps wu:fc54b05, anticorps wu:fv52d11, anticorps zgc:77109, anticorps prl-3, anticorps prl3, anticorps ptpcaax3, anticorps PTP4A3, anticorps AV088979, anticorps Prl-3, anticorps pPtp4a3, anticorps protein tyrosine phosphatase type IVA, member 3, anticorps protein tyrosine phosphatase type IVA, member 3 L homeolog, anticorps protein tyrosine phosphatase 4a3, anticorps PTP4A3, anticorps ptp4a3, anticorps ptp4a3.L, anticorps Ptp4a3

Sujet: PTP4A3 belongs to a small class of prenylated protein tyrosine phosphatases (PTPs). PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This class of PTPs contains a PTP domain and a characteristic C-terminal prenylation motif. Studies of this class of PTPs in mice demonstrated that they were prenylated proteins in vivo, which suggested their association with cell plasma membrane. Overexpression of this gene in mammalian cells was reported to inhibit angiotensin-II induced cell calcium mobilization and promote cell growth.

Poids moléculaire: 19 kDa (MW of target protein)