MPP3 anticorps
-
- Antigène Voir toutes MPP3 Anticorps
- MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCL
- Top Product
- Discover our top product MPP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPP3 Blocking Peptide, catalog no. 33R-3635, is also available for use as a blocking control in assays to test for specificity of this MPP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))
- Autre désignation
- MPP3 (MPP3 Produits)
- Synonymes
- anticorps DLG3, anticorps 6430514B01, anticorps Dlgh3, anticorps CSG18, anticorps Dlg3, anticorps Dusp3, anticorps si:ch73-368i2.1, anticorps membrane palmitoylated protein 3, anticorps membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3), anticorps membrane protein, palmitoylated 3a (MAGUK p55 subfamily member 3), anticorps MPP3, anticorps Mpp3, anticorps mpp3a
- Sujet
- This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions
- Poids moléculaire
- 66 kDa (MW of target protein)
-