MPP2 anticorps

N° du produit ABIN631237

Détail du produit anti-MPP2 anticorps

Antigène: MPP2 (Membrane Protein, Palmitoylated 2 (MAGUK P55 Subfamily Member 2) (MPP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MPP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPP2 Blocking Peptide, catalog no. 33R-7575, is also available for use as a blocking control in assays to test for specificity of this MPP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPP2

Antigène: MPP2 (Membrane Protein, Palmitoylated 2 (MAGUK P55 Subfamily Member 2) (MPP2))

Autre désignation: MPP2 (MPP2 Produits)

Synonymes: anticorps D11Bwg0652e, anticorps Dlg2, anticorps Dlgh2, anticorps Pals4, anticorps DLG2, anticorps zgc:171280, anticorps mpp2, anticorps zgc:92011, anticorps membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2), anticorps membrane palmitoylated protein 2, anticorps membrane protein, palmitoylated 2a (MAGUK p55 subfamily member 2), anticorps membrane protein, palmitoylated 2 S homeolog, anticorps membrane protein, palmitoylated 2b (MAGUK p55 subfamily member 2), anticorps Mpp2, anticorps MPP2, anticorps mpp2a, anticorps mpp2.S, anticorps mpp2b

Sujet: Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs).

Poids moléculaire: 61 kDa (MW of target protein)