LANCL2 anticorps

N° du produit ABIN631238

Détail du produit anti-LANCL2 anticorps

Antigène: LANCL2 (LanC like 2 (LANCL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LANCL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LANCL2 Blocking Peptide, catalog no. 33R-2598, is also available for use as a blocking control in assays to test for specificity of this LANCL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LANCL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LANCL2

Antigène: LANCL2 (LanC like 2 (LANCL2))

Autre désignation: LANCL2 (LANCL2 Produits)

Synonymes: anticorps 1700003F10Rik, anticorps GPR69B, anticorps TASP, anticorps LanC (bacterial lantibiotic synthetase component C)-like 2, anticorps LanC like 2, anticorps Lancl2, anticorps LANCL2

Sujet: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Poids moléculaire: 51 kDa (MW of target protein)