LANCL2 anticorps
-
- Antigène Voir toutes LANCL2 Anticorps
- LANCL2 (LanC like 2 (LANCL2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LANCL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK
- Top Product
- Discover our top product LANCL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LANCL2 Blocking Peptide, catalog no. 33R-2598, is also available for use as a blocking control in assays to test for specificity of this LANCL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LANCL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LANCL2 (LanC like 2 (LANCL2))
- Autre désignation
- LANCL2 (LANCL2 Produits)
- Synonymes
- anticorps 1700003F10Rik, anticorps GPR69B, anticorps TASP, anticorps LanC (bacterial lantibiotic synthetase component C)-like 2, anticorps LanC like 2, anticorps Lancl2, anticorps LANCL2
- Sujet
- LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
- Poids moléculaire
- 51 kDa (MW of target protein)
-