GCAP1 anticorps

N° du produit ABIN631244

Détail du produit anti-GCAP1 anticorps

Antigène: GCAP1 (GUCA1A) (Guanylate Cyclase Activator 1A (Retina) (GUCA1A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCAP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GUCA1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GUCA1A Blocking Peptide, catalog no. 33R-5562, is also available for use as a blocking control in assays to test for specificity of this GUCA1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUCA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCAP1

Antigène: GCAP1 (GUCA1A) (Guanylate Cyclase Activator 1A (Retina) (GUCA1A))

Autre désignation: GUCA1A (GUCA1A Produits)

Synonymes: anticorps C6orf131, anticorps COD3, anticorps CORD14, anticorps GCAP, anticorps GCAP1, anticorps GUCA, anticorps GUCA1, anticorps dJ139D8.6, anticorps MGC84170, anticorps GUCA1A, anticorps guca1a, anticorps MGC146317, anticorps GC-A, anticorps Gcap1, anticorps Guca1, anticorps mGCAP1, anticorps gcap1, anticorps guanylate cyclase activator 1A, anticorps guanylate cyclase activator 1A L homeolog, anticorps guanylate cyclase activator 1A (retina), anticorps guanylate cyclase activator 1a (retina), anticorps GUCA1A, anticorps Guca1a, anticorps guca1a.L, anticorps guca1a

Sujet: GUCA1A(GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction