AKAP7 anticorps

N° du produit ABIN631246

Détail du produit anti-AKAP7 anticorps

Antigène: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP7 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKAP7 Blocking Peptide, catalog no. 33R-6062, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKAP7

Antigène: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Autre désignation: AKAP7 (AKAP7 Produits)

Synonymes: anticorps akap15, anticorps akap18, anticorps MGC83920, anticorps AKAP7, anticorps AKAP15, anticorps AKAP18, anticorps 6430401D08, anticorps AI662165, anticorps Akap18, anticorps BB170514, anticorps AKAP-18, anticorps AKAP18d, anticorps Akap15, anticorps A-kinase anchoring protein 7, anticorps A-kinase anchoring protein 7 L homeolog, anticorps A kinase (PRKA) anchor protein 7, anticorps AKAP7, anticorps akap7.L, anticorps akap7, anticorps Akap7

Sujet: AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.

Poids moléculaire: 11 kDa (MW of target protein)