PPM1B anticorps

N° du produit ABIN631255

Détail du produit anti-PPM1B anticorps

Antigène: PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPM1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPM1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPM1B Blocking Peptide, catalog no. 33R-2480, is also available for use as a blocking control in assays to test for specificity of this PPM1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPM1B

Antigène: PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))

Autre désignation: PPM1B (PPM1B Produits)

Synonymes: anticorps PP2C-beta-X, anticorps PP2CB, anticorps PP2CBETA, anticorps PPC2BETAX, anticorps Pp2c2, anticorps fc18g04, anticorps ppm1a, anticorps wu:fc18g04, anticorps zgc:92329, anticorps pp2c-beta-x, anticorps pp2cb, anticorps pp2cbeta, anticorps ppc2betax, anticorps zgc:92031, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1B, anticorps protein phosphatase 1B, magnesium dependent, beta isoform, anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1B, anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1Bb, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1B L homeolog, anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1Ba, anticorps PPM1B, anticorps Ppm1b, anticorps ppm1bb, anticorps ppm1b.L, anticorps ppm1ba

Sujet: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Poids moléculaire: 21 kDa (MW of target protein)