Ketohexokinase anticorps

N° du produit ABIN631256

Détail du produit anti-Ketohexokinase anticorps

Antigène: Ketohexokinase (KHK)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ketohexokinase est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KHK Blocking Peptide, catalog no. 33R-2992, is also available for use as a blocking control in assays to test for specificity of this KHK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ketohexokinase

Antigène: Ketohexokinase (KHK)

Autre désignation: KHK (KHK Produits)

Synonymes: anticorps wu:fj68h03, anticorps zgc:92219, anticorps zgc:92626, anticorps KHK, anticorps khk, anticorps KETHPRO, anticorps ketohexokinase, anticorps Ketohexokinase, anticorps KHK, anticorps khk, anticorps Hhal_0921, anticorps AaeL_AAEL006316, anticorps Nwat_0240, anticorps Khk

Sujet: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.

Poids moléculaire: 32 kDa (MW of target protein)