NLRP1 anticorps (N-Term)

N° du produit ABIN631304

L’anticorps Lapin Polyclonal anti-NLRP1 a été validé pour WB. Il convient pour détecter NLRP1 dans des échantillons de Humain et Souris.

Aperçu rapide pour NLRP1 anticorps (N-Term) (ABIN631304)

Antigène: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NLRP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NLRP1 anticorps

Épitope: N-Term

Specificité: NLRP1 antibody was raised against the N terminal of NLRP1

Purification: Affinity purified

Immunogène: NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NLRP1 Blocking Peptide, (ABIN937590), is also available for use as a blocking control in assays to test for specificity of this NLRP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLRP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NLRP1

Antigène: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Autre désignation: NLRP1

Sujet: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death.

Poids moléculaire: 155 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Inflammasome