NLRP1 anticorps (N-Term)

N° du produit ABIN631304

Détail du produit anti-NLRP1 anticorps

Antigène: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NLRP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NLRP1 antibody was raised against the N terminal of NLRP1

Purification: Affinity purified

Immunogène: NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NLRP1 Blocking Peptide, catalog no. 33R-2204, is also available for use as a blocking control in assays to test for specificity of this NLRP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLRP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NLRP1

Antigène: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Autre désignation: NLRP1 (NLRP1 Produits)

Synonymes: anticorps CARD7, anticorps CIDED, anticorps CLR17.1, anticorps DEFCAP, anticorps DEFCAP-L/S, anticorps NAC, anticorps NALP1, anticorps PP1044, anticorps SLEV1, anticorps VAMAS1, anticorps NLR family pyrin domain containing 1, anticorps NLRP1, anticorps Nlrp1

Sujet: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death.

Poids moléculaire: 155 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Inflammasome