LYRM1 anticorps (Middle Region)

N° du produit ABIN631306

Détail du produit anti-LYRM1 anticorps

Antigène: LYRM1 (LYR Motif Containing 1 (LYRM1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYRM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYRM1 antibody was raised against the middle region of LYRM1

Purification: Affinity purified

Immunogène: LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYRM1 Blocking Peptide, catalog no. 33R-4341, is also available for use as a blocking control in assays to test for specificity of this LYRM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYRM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYRM1

Antigène: LYRM1 (LYR Motif Containing 1 (LYRM1))

Autre désignation: LYRM1 (LYRM1 Produits)

Synonymes: anticorps A211C6.1, anticorps 1110065L10Rik, anticorps 2310004B22Rik, anticorps 4930404J24Rik, anticorps RGD1563498, anticorps wu:fj36g10, anticorps zgc:92830, anticorps LYR motif containing 1, anticorps LYR motif containing 1 S homeolog, anticorps LYRM1, anticorps lyrm1, anticorps Lyrm1, anticorps lyrm1.S

Sujet: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Poids moléculaire: 14 kDa (MW of target protein)