PTGES3 anticorps

N° du produit ABIN631318

Détail du produit anti-PTGES3 anticorps

Antigène: PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGES3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTGES3 Blocking Peptide, catalog no. 33R-4309, is also available for use as a blocking control in assays to test for specificity of this PTGES3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGES3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTGES3

Antigène: PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))

Autre désignation: PTGES3 (PTGES3 Produits)

Synonymes: anticorps P23, anticorps TEBP, anticorps cPGES, anticorps PTGES3, anticorps 5730442A20Rik, anticorps Ptges, anticorps Tebp, anticorps p23, anticorps sid3177, anticorps RGD1561913, anticorps CPGES, anticorps cPGES-1, anticorps ptges3, anticorps wu:fb98d06, anticorps zgc:65804, anticorps zgc:77131, anticorps tebp, anticorps wu:fb50a04, anticorps zgc:86751, anticorps prostaglandin E synthase 3, anticorps prostaglandin E synthase 3 (cytosolic) pseudogene, anticorps prostaglandin E synthase 3a (cytosolic), anticorps prostaglandin E synthase 3 L homeolog, anticorps prostaglandin E synthase 3b (cytosolic), anticorps PTGES3, anticorps LOC743066, anticorps Ptges3, anticorps ptges3a, anticorps ptges3.L, anticorps ptges3b

Sujet: PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Cellular Glucan Metabolic Process