PTGES3 anticorps
-
- Antigène Voir toutes PTGES3 Anticorps
- PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTGES3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM
- Top Product
- Discover our top product PTGES3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTGES3 Blocking Peptide, catalog no. 33R-4309, is also available for use as a blocking control in assays to test for specificity of this PTGES3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGES3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))
- Autre désignation
- PTGES3 (PTGES3 Produits)
- Synonymes
- anticorps P23, anticorps TEBP, anticorps cPGES, anticorps PTGES3, anticorps 5730442A20Rik, anticorps Ptges, anticorps Tebp, anticorps p23, anticorps sid3177, anticorps RGD1561913, anticorps CPGES, anticorps cPGES-1, anticorps ptges3, anticorps wu:fb98d06, anticorps zgc:65804, anticorps zgc:77131, anticorps tebp, anticorps wu:fb50a04, anticorps zgc:86751, anticorps prostaglandin E synthase 3, anticorps prostaglandin E synthase 3 (cytosolic) pseudogene, anticorps prostaglandin E synthase 3a (cytosolic), anticorps prostaglandin E synthase 3 L homeolog, anticorps prostaglandin E synthase 3b (cytosolic), anticorps PTGES3, anticorps LOC743066, anticorps Ptges3, anticorps ptges3a, anticorps ptges3.L, anticorps ptges3b
- Sujet
- PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.
- Poids moléculaire
- 18 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Cellular Glucan Metabolic Process
-