TRIM36 anticorps (Middle Region)

N° du produit ABIN631325

Détail du produit anti-TRIM36 anticorps

Antigène: TRIM36 (Tripartite Motif Containing 36 (TRIM36))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM36 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM36 antibody was raised against the middle region of TRIM36

Purification: Affinity purified

Immunogène: TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM36 Blocking Peptide, catalog no. 33R-3678, is also available for use as a blocking control in assays to test for specificity of this TRIM36 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM36

Antigène: TRIM36 (Tripartite Motif Containing 36 (TRIM36))

Autre désignation: TRIM36 (TRIM36 Produits)

Synonymes: anticorps wu:fj48f01, anticorps zgc:153447, anticorps zgc:63476, anticorps Haprin, anticorps MGC81170, anticorps TRIM36, anticorps HAPRIN, anticorps RBCC728, anticorps RNF98, anticorps D18Wsu100e, anticorps haprin, anticorps tripartite motif containing 36, anticorps tripartite motif containing 36 L homeolog, anticorps tripartite motif-containing 36, anticorps trim36, anticorps trim36.L, anticorps TRIM36, anticorps Trim36

Sujet: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Poids moléculaire: 7 kDa (MW of target protein)