EEF1G anticorps (Middle Region)
-
- Antigène Voir toutes EEF1G Anticorps
- EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EEF1G est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EEF1 G antibody was raised against the middle region of EEF1
- Purification
- Affinity purified
- Immunogène
- EEF1 G antibody was raised using the middle region of EEF1 corresponding to a region with amino acids RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE
- Top Product
- Discover our top product EEF1G Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EEF1G Blocking Peptide, catalog no. 33R-7829, is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))
- Autre désignation
- EEF1G (EEF1G Produits)
- Synonymes
- anticorps EF1G, anticorps GIG35, anticorps eEF-1 gamma, anticorps db03h10, anticorps fk76a09, anticorps mg:db03h10, anticorps wu:fk76a09, anticorps 2610301D06Rik, anticorps AA407312, anticorps eef1g, anticorps ef1g, anticorps gig35, anticorps eukaryotic translation elongation factor 1 gamma, anticorps eukaryotic translation elongation factor 1 gamma L homeolog, anticorps eukaryotic translation elongation factor 1 gamma S homeolog, anticorps EEF1G, anticorps eef1g, anticorps Eef1g, anticorps eef1g.L, anticorps eef1g.S, anticorps EHI_119540, anticorps CMU_014590
- Sujet
- EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.
- Poids moléculaire
- 50 kDa (MW of target protein)
-