EEF1G anticorps (Middle Region)

N° du produit ABIN631329

Détail du produit anti-EEF1G anticorps

Antigène: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EEF1G est non-conjugé

Application: Western Blotting (WB)

Specificité: EEF1 G antibody was raised against the middle region of EEF1

Purification: Affinity purified

Immunogène: EEF1 G antibody was raised using the middle region of EEF1 corresponding to a region with amino acids RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EEF1G Blocking Peptide, catalog no. 33R-7829, is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EEF1G

Antigène: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Autre désignation: EEF1G (EEF1G Produits)

Synonymes: anticorps EF1G, anticorps GIG35, anticorps eEF-1 gamma, anticorps db03h10, anticorps fk76a09, anticorps mg:db03h10, anticorps wu:fk76a09, anticorps 2610301D06Rik, anticorps AA407312, anticorps eef1g, anticorps ef1g, anticorps gig35, anticorps eukaryotic translation elongation factor 1 gamma, anticorps eukaryotic translation elongation factor 1 gamma L homeolog, anticorps eukaryotic translation elongation factor 1 gamma S homeolog, anticorps EEF1G, anticorps eef1g, anticorps Eef1g, anticorps eef1g.L, anticorps eef1g.S, anticorps EHI_119540, anticorps CMU_014590

Sujet: EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Poids moléculaire: 50 kDa (MW of target protein)