NSMCE1 anticorps
-
- Antigène Voir toutes NSMCE1 Anticorps
- NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NSMCE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN
- Top Product
- Discover our top product NSMCE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NSMCE1 Blocking Peptide, catalog no. 33R-4454, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))
- Autre désignation
- NSMCE1 (NSMCE1 Produits)
- Synonymes
- anticorps zgc:92777, anticorps NSMCE1, anticorps NSE1, anticorps 2510027N19Rik, anticorps RGD1307760, anticorps NSE1 homolog, SMC5-SMC6 complex component, anticorps NSE1 homolog, SMC5-SMC6 complex component L homeolog, anticorps nsmce1, anticorps NSMCE1, anticorps nsmce1.L, anticorps Nsmce1
- Sujet
- NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- Positive Regulation of Response to DNA Damage Stimulus
-