Involucrin anticorps (N-Term)

N° du produit ABIN631419

Détail du produit anti-Involucrin anticorps

Antigène: Involucrin (IVL)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Involucrin est non-conjugé

Application: Western Blotting (WB)

Specificité: Involucrin antibody was raised against the N terminal of IVL

Purification: Affinity purified

Immunogène: Involucrin antibody was raised using the N terminal of IVL corresponding to a region with amino acids AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Involucrin Blocking Peptide, catalog no. 33R-1140, is also available for use as a blocking control in assays to test for specificity of this Involucrin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Involucrin

Antigène: Involucrin (IVL)

Autre désignation: Involucrin (IVL Produits)

Synonymes: anticorps INV, anticorps NPH2, anticorps NPHP2, anticorps 1110019C06Rik, anticorps IVL, anticorps Nphp2, anticorps inv, anticorps involucrin, anticorps inversin, anticorps IVL, anticorps INVS, anticorps Ivl, anticorps Invs

Sujet: Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase.Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. This gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and calcyclin.

Poids moléculaire: 68 kDa (MW of target protein)