TTC8 anticorps (N-Term)

N° du produit ABIN631427

Détail du produit anti-TTC8 anticorps

Antigène: TTC8 (Tetratricopeptide Repeat Domain 8 (TTC8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC8 est non-conjugé

Application: Western Blotting (WB)

Specificité: TTC8 antibody was raised against the N terminal of TTC8

Purification: Affinity purified

Immunogène: TTC8 antibody was raised using the N terminal of TTC8 corresponding to a region with amino acids ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC8 Blocking Peptide, catalog no. 33R-2599, is also available for use as a blocking control in assays to test for specificity of this TTC8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC8

Antigène: TTC8 (Tetratricopeptide Repeat Domain 8 (TTC8))

Autre désignation: TTC8 (TTC8 Produits)

Synonymes: anticorps TTC8, anticorps bbs8, anticorps fk26c02, anticorps wu:fk26c02, anticorps zgc:136718, anticorps DKFZp459L2429, anticorps BBS8, anticorps RP51, anticorps 0610012F22Rik, anticorps AV001447, anticorps tetratricopeptide repeat domain 8, anticorps TTC8, anticorps ttc8, anticorps lpa_01174, anticorps Ttc8

Sujet: The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Signalisation Hedgehog