KRT16 anticorps

N° du produit ABIN631442

Détail du produit anti-KRT16 anticorps

Antigène: KRT16 (Keratin 16 (KRT16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRT16 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 16 Blocking Peptide, catalog no. 33R-3889, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRT16

Antigène: KRT16 (Keratin 16 (KRT16))

Autre désignation: Cytokeratin 16 (KRT16 Produits)

Synonymes: anticorps CK16, anticorps FNEPPK, anticorps K16, anticorps K1CP, anticorps KRT16A, anticorps NEPPK, anticorps AI324768, anticorps Krt1-16, anticorps Ka16, anticorps KRT16, anticorps Krt16, anticorps keratin 16, anticorps keratin 16, type I S homeolog, anticorps keratin, type I cytoskeletal 16, anticorps KRT16, anticorps Krt16, anticorps krt16.S, anticorps LOC101108147, anticorps LOC100714013

Sujet: KRT16 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles.

Poids moléculaire: 51 kDa (MW of target protein)