Golgin A7 anticorps (Middle Region)
-
- Antigène Voir toutes Golgin A7 (GOLGA7) Anticorps
- Golgin A7 (GOLGA7)
-
Épitope
- Middle Region
-
Reactivité
- Souris, Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Golgin A7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GOLGA7 antibody was raised against the middle region of GOLGA7
- Purification
- Affinity purified
- Immunogène
- GOLGA7 antibody was raised using the middle region of GOLGA7 corresponding to a region with amino acids ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL
- Top Product
- Discover our top product GOLGA7 Anticorps primaire
-
anti-Golgin A7 (GOLGA7) (AA 1-137) antibody
GOLGA7 Reactivité: Humain WB, ELISA, IP Hôte: Souris Monoclonal 2H8 unconjugated
anti-Golgin A7 (GOLGA7) antibodyGOLGA7 Reactivité: Souris, Humain, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (AA 1-134) antibodyGOLGA7 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (N-Term) antibodyGOLGA7 Reactivité: Souris, Humain, Boeuf (Vache), Lapin, Chien, Cheval, Poisson zèbre (Danio rerio), Porc, Singe, Roussette (Chauve-souris), Xenopus laevis, Poulet WB Hôte: Lapin Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (AA 71-120) antibodyGOLGA7 Reactivité: Souris, Humain, Rat, Boeuf (Vache), Lapin, Chien, Cheval, Cobaye, Porc, Singe, Roussette (Chauve-souris) WB Hôte: Lapin Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (N-Term) antibodyGOLGA7 Reactivité: Souris, Humain, Rat, Boeuf (Vache), Lapin, Chien, Cheval, Poisson zèbre (Danio rerio), Cobaye, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (Middle Region) antibodyGOLGA7 Reactivité: Souris, Humain, Rat, Boeuf (Vache), Lapin, Chien, Cheval, Poisson zèbre (Danio rerio), Cobaye WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GOLGA7 Blocking Peptide, catalog no. 33R-1074, is also available for use as a blocking control in assays to test for specificity of this GOLGA7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGA7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Golgin A7 (GOLGA7)
- Autre désignation
- GOLGA7 (GOLGA7 Produits)
- Synonymes
- anticorps gcp16, anticorps golga7a, anticorps hspc041, anticorps MGC79092, anticorps golga3ap1, anticorps AB041568, anticorps C130038N16Rik, anticorps GCP16, anticorps GOLGA3AP1, anticorps HSPC041, anticorps R75586, anticorps GOLGA7A, anticorps golgin A7 L homeolog, anticorps golgin A7, anticorps golgi autoantigen, golgin subfamily a, 7, anticorps golga7.L, anticorps golga7, anticorps Golga7, anticorps GOLGA7
- Sujet
- GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
- Poids moléculaire
- 16 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-
