TOE1 anticorps

N° du produit ABIN631480

Détail du produit anti-TOE1 anticorps

Antigène: TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOE1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOE1 Blocking Peptide, catalog no. 33R-9872, is also available for use as a blocking control in assays to test for specificity of this TOE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOE1

Antigène: TOE1 (Target of EGR1, Member 1 (Nuclear) (TOE1))

Autre désignation: TOE1 (TOE1 Produits)

Synonymes: anticorps 4930584N22Rik, anticorps 4933424D16Rik, anticorps AI413517, anticorps TOE1, anticorps si:dkey-40i22.3, anticorps target of EGR1, exonuclease, anticorps target of EGR1, member 1 (nuclear), anticorps TOE1, anticorps Toe1, anticorps toe1

Sujet: TOE1 belongs to the CAF1 family and 1 C3H1-type zinc finger. TOE1 inhibits cell growth rate and cell cycle. It induces CDKN1A expression as well as TGF-beta expression and mediates the inhibitory growth effect of EGR1.

Poids moléculaire: 56 kDa (MW of target protein)