beta Tubulin 2A (Middle Region) anticorps

N° du produit ABIN631482

Détail du produit

Antigène: beta Tubulin 2A

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Arabidopsis, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Specificité: Beta Tubulin 2 A antibody was raised against the middle region of TUBB2

Purification: Affinity purified

Immunogène: Beta Tubulin 2 A antibody was raised using the middle region of TUBB2 corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Tubulin 2A Blocking Peptide, catalog no. 33R-1609, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: beta Tubulin 2A

Synonymes: anticorps 2t, anticorps B2t, anticorps BETA 85D, anticorps BETA2, anticorps CG9359, anticorps D.m.BETA-85D, anticorps DTB4, anticorps Dmbeta2, anticorps Dmel\\CG9359, anticorps Tub, anticorps beta(2)Tu, anticorps beta(2)Tub, anticorps beta-Tub85D, anticorps beta-tub, anticorps beta-tub85D, anticorps beta2, anticorps beta2-tub, anticorps beta2t, anticorps beta2tub, anticorps beta85D, anticorps betaTub2, anticorps beta[[2]]-tubulin, anticorps ms(3)KK[D], anticorps beta-Tubulin at 85D, anticorps betaTub85D

Sujet: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Poids moléculaire: 49 kDa (MW of target protein)