KNG1 anticorps (Middle Region)

N° du produit ABIN631493

Détail du produit anti-KNG1 anticorps

Antigène: KNG1 (Kininogen 1 (KNG1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KNG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KNG1 antibody was raised against the middle region of KNG1

Purification: Affinity purified

Immunogène: KNG1 antibody was raised using the middle region of KNG1 corresponding to a region with amino acids YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KNG1 Blocking Peptide, catalog no. 33R-10197, is also available for use as a blocking control in assays to test for specificity of this KNG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KNG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KNG1

Antigène: KNG1 (Kininogen 1 (KNG1))

Autre désignation: KNG1 (KNG1 Produits)

Synonymes: anticorps BDK, anticorps BK, anticorps KNG, anticorps Kng, anticorps KNG2, anticorps fb64g01, anticorps wu:fb64g01, anticorps zgc:103569, anticorps kininogen, anticorps bdk, anticorps kng, anticorps KNG1, anticorps IHRP, anticorps KINKG, anticorps KINKH, anticorps Kng1, anticorps Kngk, anticorps kininogen 1, anticorps kininogen 1 L homeolog, anticorps inter-alpha-trypsin inhibitor heavy chain family member 4, anticorps kininogen 2-like 1, anticorps KNG1, anticorps Kng1, anticorps kng1, anticorps kng1.L, anticorps ITIH4, anticorps Kng2l1

Sujet: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Glycosaminoglycan Metabolic Process