SDSL anticorps (N-Term)
-
- Antigène Voir toutes SDSL Anticorps
- SDSL (Serine Dehydratase-Like (SDSL))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SDSL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SDSL antibody was raised against the N terminal of SDSL
- Purification
- Affinity purified
- Immunogène
- SDSL antibody was raised using the N terminal of SDSL corresponding to a region with amino acids MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR
- Top Product
- Discover our top product SDSL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SDSL Blocking Peptide, catalog no. 33R-5836, is also available for use as a blocking control in assays to test for specificity of this SDSL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDSL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SDSL (Serine Dehydratase-Like (SDSL))
- Autre désignation
- SDSL (SDSL Produits)
- Synonymes
- anticorps MGC68790, anticorps SDSL, anticorps sds-rs1, anticorps MGC159817, anticorps SDH 2, anticorps SDS-RS1, anticorps TDH, anticorps 4432411H13Rik, anticorps AI504310, anticorps SDH1, anticorps serine dehydratase like S homeolog, anticorps serine dehydratase like, anticorps serine dehydratase, anticorps serine dehydratase-like, anticorps sdsl.S, anticorps SDSL, anticorps sdsl, anticorps SDS, anticorps LOC100367535, anticorps LOC100539678, anticorps LOC100634528, anticorps Sdsl
- Sujet
- SDSL has low serine dehydratase and threonine dehydratase activity.
- Poids moléculaire
- 35 kDa (MW of target protein)
-