GSTA3 anticorps (Middle Region)

N° du produit ABIN631512

Détail du produit anti-GSTA3 anticorps

Antigène: GSTA3 (Glutathione S-Transferase alpha 3 (GSTA3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTA3 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSTA3 antibody was raised against the middle region of GSTA3

Purification: Affinity purified

Immunogène: GSTA3 antibody was raised using the middle region of GSTA3 corresponding to a region with amino acids SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTA3 Blocking Peptide, catalog no. 33R-8822, is also available for use as a blocking control in assays to test for specificity of this GSTA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTA3

Antigène: GSTA3 (Glutathione S-Transferase alpha 3 (GSTA3))

Autre désignation: GSTA3 (GSTA3 Produits)

Synonymes: anticorps GSTA3, anticorps GST, anticorps GSTA1, anticorps GSTA3-3, anticorps GTA3, anticorps GSTA2, anticorps Gst2-3, anticorps Yc2, anticorps glutathione S-transferase alpha 3, anticorps glutathione S-transferase A2, anticorps glutathione S-transferase, anticorps glutathione S-transferase, alpha 3, anticorps glutathione S-transferase Yc, anticorps GSTA3, anticorps LOC474938, anticorps gsta3, anticorps Gsta3, anticorps LOC100328911

Sujet: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta.

Poids moléculaire: 25 kDa (MW of target protein)