DRG1 anticorps (Middle Region)
-
- Antigène Voir toutes DRG1 Anticorps
- DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DRG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DRG1 antibody was raised against the middle region of DRG1
- Purification
- Affinity purified
- Immunogène
- DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL
- Top Product
- Discover our top product DRG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DRG1 Blocking Peptide, catalog no. 33R-9670, is also available for use as a blocking control in assays to test for specificity of this DRG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))
- Autre désignation
- DRG1 (DRG1 Produits)
- Synonymes
- anticorps NEDD3, anticorps wu:fb06g12, anticorps zgc:64124, anticorps xdrg, anticorps xdrg1, anticorps MGC122865, anticorps AA408859, anticorps AI132520, anticorps Nedd3, anticorps developmentally regulated GTP binding protein 1, anticorps developmentally regulated GTP binding protein 1 L homeolog, anticorps DRG1, anticorps Drg1, anticorps drg1, anticorps drg1.L
- Sujet
- DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.
- Poids moléculaire
- 26 kDa (MW of target protein)
-