CHST14 anticorps
-
- Antigène Voir toutes CHST14 Anticorps
- CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHST14 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
- Top Product
- Discover our top product CHST14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHST14 Blocking Peptide, catalog no. 33R-7896, is also available for use as a blocking control in assays to test for specificity of this CHST14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))
- Autre désignation
- CHST14 (CHST14 Produits)
- Synonymes
- anticorps ATCS, anticorps D4ST1, anticorps HNK1ST, anticorps 2600016L03Rik, anticorps D4ST-1, anticorps D4st1, anticorps d4st1, anticorps MGC136487, anticorps wu:fc04a01, anticorps zgc:136487, anticorps carbohydrate sulfotransferase 14, anticorps carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14, anticorps CHST14, anticorps Chst14, anticorps chst14
- Sujet
- CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-