PPIL3 anticorps

N° du produit ABIN631557

Détail du produit anti-PPIL3 anticorps

Antigène: PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIL3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIL3 Blocking Peptide, catalog no. 33R-1233, is also available for use as a blocking control in assays to test for specificity of this PPIL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIL3

Antigène: PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))

Autre désignation: PPIL3 (PPIL3 Produits)

Synonymes: anticorps MGC89451, anticorps CYPJ, anticorps Cyp10l, anticorps 2310076N22Rik, anticorps 2510026K04Rik, anticorps peptidylprolyl isomerase like 3, anticorps peptidylprolyl isomerase (cyclophilin)-like 3, anticorps ppil3, anticorps PPIL3, anticorps Ppil3

Sujet: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome