FAIM anticorps (Middle Region)
-
- Antigène Voir toutes FAIM Anticorps
- FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAIM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAIM antibody was raised against the middle region of FAIM
- Purification
- Affinity purified
- Immunogène
- FAIM antibody was raised using the middle region of FAIM corresponding to a region with amino acids FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK
- Top Product
- Discover our top product FAIM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAIM Blocking Peptide, catalog no. 33R-3050, is also available for use as a blocking control in assays to test for specificity of this FAIM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAIM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))
- Autre désignation
- FAIM (FAIM Produits)
- Synonymes
- anticorps FAIM1, anticorps FAIM, anticorps faim, anticorps zgc:92712, anticorps zgc:92723, anticorps Fas apoptotic inhibitory molecule, anticorps Fas apoptotic inhibitory molecule L homeolog, anticorps Fas apoptotic inhibitory molecule b, anticorps Fas apoptotic inhibitory molecule a, anticorps FAIM, anticorps Faim, anticorps faim, anticorps faim.L, anticorps Tsp_00038, anticorps faimb, anticorps faima
- Sujet
- FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
- Poids moléculaire
- 24 kDa (MW of target protein)
-