MTMR12 anticorps (Middle Region)
-
- Antigène Voir toutes MTMR12 Anticorps
- MTMR12 (Myotubularin Related Protein 12 (MTMR12))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MTMR12 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MTMR12 antibody was raised against the middle region of MTMR12
- Purification
- Affinity purified
- Immunogène
- MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK
- Top Product
- Discover our top product MTMR12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MTMR12 Blocking Peptide, catalog no. 33R-7217, is also available for use as a blocking control in assays to test for specificity of this MTMR12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MTMR12 (Myotubularin Related Protein 12 (MTMR12))
- Autre désignation
- MTMR12 (MTMR12 Produits)
- Synonymes
- anticorps PIP3AP, anticorps MTMR12, anticorps 3-PAP, anticorps 3Pap, anticorps 4932703C11, anticorps C730015A02Rik, anticorps Pip3ap, anticorps mKIAA1682, anticorps im:7160376, anticorps pip3ap, anticorps myotubularin related protein 12, anticorps MTMR12, anticorps mtmr12, anticorps Mtmr12
- Sujet
- MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.
- Poids moléculaire
- 86 kDa (MW of target protein)
-