METTL2B anticorps (N-Term)

N° du produit ABIN631601

L’anticorps anti-METTL2B Polyclonal Lapin est utilisé pour la détection de METTL2B dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour METTL2B anticorps (N-Term) (ABIN631601)

Antigène: METTL2B (Methyltransferase Like 2B (METTL2B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL2B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-METTL2B anticorps

Épitope: N-Term

Specificité: METTL2 B antibody was raised against the N terminal of METTL2

Purification: Affinity purified

Immunogène: METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METTL2B Blocking Peptide, (ABIN939456), is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL2B

Antigène: METTL2B (Methyltransferase Like 2B (METTL2B))

Autre désignation: METTL2B

Sujet: METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.

Poids moléculaire: 43 kDa (MW of target protein)