METTL2B anticorps (N-Term)
-
- Antigène Voir toutes METTL2B Anticorps
- METTL2B (Methyltransferase Like 2B (METTL2B))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp METTL2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- METTL2 B antibody was raised against the N terminal of METTL2
- Purification
- Affinity purified
- Immunogène
- METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS
- Top Product
- Discover our top product METTL2B Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
METTL2B Blocking Peptide, catalog no. 33R-4070, is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- METTL2B (Methyltransferase Like 2B (METTL2B))
- Autre désignation
- METTL2B (METTL2B Produits)
- Synonymes
- anticorps METL, anticorps METTL2, anticorps METTL2A, anticorps PSENIP1, anticorps Mettl2, anticorps methyltransferase like 2B, anticorps METTL2B, anticorps Mettl2b
- Sujet
- METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.
- Poids moléculaire
- 43 kDa (MW of target protein)
-