TRMT2B anticorps (N-Term)

N° du produit ABIN631605

Détail du produit anti-TRMT2B anticorps

Antigène: TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRMT2B est non-conjugé

Application: Western Blotting (WB)

Specificité: CXORF34 antibody was raised against the N terminal Of Cxorf34

Purification: Affinity purified

Immunogène: CXORF34 antibody was raised using the N terminal Of Cxorf34 corresponding to a region with amino acids PPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CXORF34 Blocking Peptide, catalog no. 33R-7256, is also available for use as a blocking control in assays to test for specificity of this CXORF34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRMT2B

Antigène: TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))

Autre désignation: CXORF34 (TRMT2B Produits)

Synonymes: anticorps CXorf34, anticorps dJ341D10.3, anticorps 4732479N06Rik, anticorps im:7160396, anticorps wu:fc49d02, anticorps zgc:162982, anticorps tRNA methyltransferase 2 homolog B, anticorps TRM2 tRNA methyltransferase 2B, anticorps TRMT2B, anticorps Trmt2b, anticorps trmt2b

Sujet: TRMT2B (CXorf34) is probable S-adenosyl-L-methionine-dependent methlytransferase that catalyzes the formation of 5-methyl-uridine at position 54 (M-5-U54) in all tRNA. And it may also have a role in tRNA stabilization or maturation.

Poids moléculaire: 56 kDa (MW of target protein)