NRD1 anticorps

N° du produit ABIN631610

Détail du produit anti-NRD1 anticorps

Antigène: NRD1 (Nardilysin (N-Arginine Dibasic Convertase) (NRD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NRD1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NRD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRD1 Blocking Peptide, catalog no. 33R-3570, is also available for use as a blocking control in assays to test for specificity of this NRD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NRD1

Antigène: NRD1 (Nardilysin (N-Arginine Dibasic Convertase) (NRD1))

Autre désignation: NRD1 (NRD1 Produits)

Synonymes: anticorps hNRD1, anticorps hNRD2, anticorps NRDC, anticorps 2600011I06Rik, anticorps AI875733, anticorps NRD-C, anticorps NRD1, anticorps si:dkey-171o17.4, anticorps DKFZp459N143, anticorps nardilysin convertase, anticorps nardilysin, N-arginine dibasic convertase, NRD convertase 1, anticorps nardilysin, anticorps nardilysin b (N-arginine dibasic convertase), anticorps NRDC, anticorps Nrdc, anticorps Nrd1, anticorps LOC552055, anticorps nrd1b, anticorps CpipJ_CPIJ002524, anticorps Tsp_03755

Sujet: NRD1 cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Poids moléculaire: 132 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development