GNL3L anticorps

N° du produit ABIN631615

Détail du produit anti-GNL3L anticorps

Antigène: GNL3L (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar)-Like (GNL3L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNL3L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GNL3 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNL3L Blocking Peptide, catalog no. 33R-6234, is also available for use as a blocking control in assays to test for specificity of this GNL3L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNL3L

Antigène: GNL3L (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar)-Like (GNL3L))

Autre désignation: GNL3L (GNL3L Produits)

Synonymes: anticorps SI:zK13A21.8, anticorps flj10613, anticorps flj10613l, anticorps si:dkey-13a21.8, anticorps zgc:110536, anticorps BC020354, anticorps guanine nucleotide binding protein-like 3 (nucleolar)-like, anticorps guanine nucleotide binding protein-like 3 (nucleolar)-like S homeolog, anticorps G protein nucleolar 3 like, anticorps gnl3l, anticorps gnl3l.S, anticorps GNL3L, anticorps Gnl3l

Sujet: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.

Poids moléculaire: 65 kDa (MW of target protein)