ANP32B anticorps

N° du produit ABIN631639

Détail du produit anti-ANP32B anticorps

Antigène: ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANP32B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ANP32 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANP32B Blocking Peptide, catalog no. 33R-3427, is also available for use as a blocking control in assays to test for specificity of this ANP32B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANP32B

Antigène: ANP32B (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member B (ANP32B))

Autre désignation: ANP32B (ANP32B Produits)

Synonymes: anticorps APRIL, anticorps PHAPI2, anticorps SSP29, anticorps 2410015B15Rik, anticorps PAL31, anticorps PHAPI2a, anticorps Ssp29, anticorps cb908, anticorps fa99a11, anticorps wu:fa28c10, anticorps wu:fa99a11, anticorps wu:fb40e12, anticorps zgc:77745, anticorps hLAMP-1, anticorps MGC80871, anticorps ANP32B, anticorps MGC69373, anticorps SLAN, anticorps acidic nuclear phosphoprotein 32 family member B, anticorps acidic (leucine-rich) nuclear phosphoprotein 32 family, member B, anticorps acidic nuclear phosphoprotein 32 family member B L homeolog, anticorps acidic leucine-rich nuclear phosphoprotein 32 family member B, anticorps ANP32B, anticorps Anp32b, anticorps anp32b, anticorps anp32b.L, anticorps LOC494442

Sujet: ANP32B is a multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. ANP32B is required for the progression from the G1 to the S phase. ANP32B is an anti-apoptotic protein which functions as a caspase-3 inhibitor. It has no phosphatase 2A (PP2A) inhibitor activity.

Poids moléculaire: 29 kDa (MW of target protein)