MPP5 anticorps
-
- Antigène Voir toutes MPP5 Anticorps
- MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPP5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREI
- Top Product
- Discover our top product MPP5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPP5 Blocking Peptide, catalog no. 33R-5436, is also available for use as a blocking control in assays to test for specificity of this MPP5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))
- Autre désignation
- MPP5 (MPP5 Produits)
- Synonymes
- anticorps PALS1, anticorps 3830420B02Rik, anticorps AI255216, anticorps AI644496, anticorps Pals1, anticorps mpp5, anticorps nok, anticorps MAGUK p55 subfamily member 5, anticorps membrane palmitoylated protein 5, anticorps membrane protein, palmitoylated 5 L homeolog, anticorps membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5), anticorps membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5), anticorps Tsp_03061, anticorps MPP5, anticorps mpp5.L, anticorps Mpp5, anticorps mpp5a
- Sujet
- Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins.
- Poids moléculaire
- 77 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Tube Formation, Asymmetric Protein Localization
-