MPP5 anticorps

N° du produit ABIN631654

Détail du produit anti-MPP5 anticorps

Antigène: MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPP5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPP5 Blocking Peptide, catalog no. 33R-5436, is also available for use as a blocking control in assays to test for specificity of this MPP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPP5

Antigène: MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))

Autre désignation: MPP5 (MPP5 Produits)

Synonymes: anticorps PALS1, anticorps 3830420B02Rik, anticorps AI255216, anticorps AI644496, anticorps Pals1, anticorps mpp5, anticorps nok, anticorps MAGUK p55 subfamily member 5, anticorps membrane palmitoylated protein 5, anticorps membrane protein, palmitoylated 5 L homeolog, anticorps membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5), anticorps membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5), anticorps Tsp_03061, anticorps MPP5, anticorps mpp5.L, anticorps Mpp5, anticorps mpp5a

Sujet: Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins.

Poids moléculaire: 77 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Tube Formation, Asymmetric Protein Localization